{ { }, { It will display the directly connected neighbors, namely RouterA and RouterB, and you can see the host names, local interfaces where you are seeing that device, and their own interface where they are seeing you. "showCountOnly" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'kklYZlNiT6SnwZr1I5N-sWYpatlIXSzAXARzkaLaR8w. ] }, Right-click the vDS and click Edit Settings. "action" : "rerender" "useSimpleView" : "false", { then under 'API access' generate new API key). } ] "context" : "envParam:quiltName,message", "event" : "editProductMessage", { "actions" : [ { "actions" : [ "linkDisabled" : "false" { } }, "event" : "expandMessage", $search.find('input.search-input').keyup(function(e) { "includeRepliesModerationState" : "true", "actions" : [ "event" : "ProductAnswer", ] } CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", If you are using Cisco switches in . ] "action" : "rerender" "parameters" : { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" The domain name that you get in show cdp nei detail" command is VTP domain name of the adjacent switch. "context" : "", "disableKudosForAnonUser" : "false", } "displayStyle" : "horizontal", }, "actions" : [ "revokeMode" : "true", }, ] "linkDisabled" : "false" { "componentId" : "forums.widget.message-view", "action" : "rerender" { "disableLinks" : "false", "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { NAS storage management. { } var $search = $('.cmp-header__search-container'); "event" : "MessagesWidgetCommentForm", } ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "MessagesWidgetCommentForm", "context" : "envParam:selectedMessage", }, "context" : "", Are you sure you want to proceed? ', 'ajax'); { { "action" : "rerender" { "action" : "pulsate" "displaySubject" : "true" "displaySubject" : "true" ] ] ","messageActionsSelector":"#messageActions_5","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_5","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "event" : "expandMessage", "disableLabelLinks" : "false", { "event" : "MessagesWidgetEditAction", { { The feature is still missing on the dashboard. "actions" : [ "action" : "addClassName" "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } { "includeRepliesModerationState" : "true", { . { ] ] { "action" : "rerender" The priority was on providing the controls which would enable Meraki-to-Meraki . { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pWw0YiVwPnc_V-1bt4vv27cWkhfeNGpyu7pEPLTyL18. ] "parameters" : { "actions" : [ }, { "parameters" : { "useCountToKudo" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "context" : "", ] "event" : "removeThreadUserEmailSubscription", "useSimpleView" : "false", "context" : "envParam:quiltName", { "}); "actions" : [ "event" : "editProductMessage", "action" : "rerender" { "action" : "pulsate" { "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName", } { { The Meraki MS390 is the most powerful access switch in the Meraki portfolio which combines the simplicity of cloud-managed IT with the power of innovative Cisco switching technology. "truncateBodyRetainsHtml" : "false", "actions" : [ } { Use information provided by Cisco Discovery Protocol (CDP) to verify proper device interconnection. "componentId" : "kudos.widget.button", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'uw2lWvnbyhhD213JoyiL7RHgUFEJq1spidC1VniTr9Y. "forceSearchRequestParameterForBlurbBuilder" : "false", { } "action" : "rerender" "actions" : [ ] LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "truncateBody" : "true", "disableLabelLinks" : "false", "displaySubject" : "true" { }, I guess I should have tried. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b197e30fd', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'pJTqxKfOOYeElVWWxfbwf2UM6EJOZ6Kr7OzvcFxKtao. This command shows detailed information about the Cisco devices that are directly connected to your current device, including IP addresses. So things like CDP are not available. { }, "actions" : [ { "actions" : [ "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "selector" : "#messageview_1", { "useTruncatedSubject" : "true", "actions" : [ "}); { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", Port status as seen in the default dashboard color mode. "actions" : [ { Are you sure you want to proceed? "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":29618,"confimationText":"You have other message editors open and your data inside of them might be lost. "action" : "pulsate" } } } "selector" : "#messageview_0", } ] } This section lists the top 10 Cisco Meraki devices in the network, ranked by total network usage, along with the total number of unique clients that used the device. } I wrote a Python script that uses Meraki API to list LLDP and CDP information for a device. { }, "linkDisabled" : "false" }, \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Cloud Monitoring for Catalyst - Early Availability Group, https://github.com/routetonull/getMerakiNeighbor. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_10f452b179b055d","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Network management. ], } "action" : "rerender" "event" : "addMessageUserEmailSubscription", "}); { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gzVq_1RKEaSIC0eSeagZ9_hj14P3pIknp5aHlMBErhI. "action" : "rerender" ] "action" : "rerender" // console.log('Header search input', e.keyCode); { "action" : "rerender" "action" : "rerender" ] }); "action" : "rerender" "showCountOnly" : "false", { }, "revokeMode" : "true", "event" : "MessagesWidgetEditCommentForm", ] "disableLabelLinks" : "false", } the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors. ] { "event" : "AcceptSolutionAction", } { { "context" : "", "context" : "", "}); Your script really steps it up. }, { "actions" : [ } "useSubjectIcons" : "true", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "eventActions" : [ } }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_10f452b179b055d","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_10f452b179b055d_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "action" : "rerender" LLDP vs CDP - Cisco Learning Network 15 lines) of information, one set for every neighbor - show cdp entry "name" = lists the same information . Dragging the columns to re-order them; Adding/removing columns using the button; Export the neighbor table by Clicking the button to copy tab-seperated data (ready to paste into a spreadsheet) to your clipboard . "message" : "99480", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:sortLabelsWidget","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#labelsTaplet","action":"sortLabelsWidget","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.labelstaplet:sortlabelswidget?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=labels/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BivIcsFIXzjEAAmRgP8R9qPwPsiiF-9V0C1UfYOXnlc. "context" : "", } "event" : "ProductAnswerComment", "actions" : [ } "actions" : [ Output will look similar to this (Output is from a 9800CL) I didn't realize how clean the 9800 AP CDP command would look like. "context" : "", }); "useSimpleView" : "false", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { ], ] "action" : "rerender" "disableKudosForAnonUser" : "false", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper","messageId":29378,"messageActionsId":"messageActions"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":true,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. }); ] }); } { { { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b19a7df72', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, '6FoqepZx2dFYXAX4A9dTEhOZqVpwTgFMdXC9n2FGsOU. "context" : "", "actions" : [ "action" : "pulsate" "actions" : [ My goal was to provide the script to a NOC to allow the operators to get the information from a simple to use CLI command. "actions" : [ "action" : "rerender" { "event" : "editProductMessage", "useCountToKudo" : "false", "actions" : [ ] "action" : "rerender" "event" : "ProductAnswer", "includeRepliesModerationState" : "true", "context" : "envParam:quiltName,message", { ', 'ajax'); "event" : "MessagesWidgetMessageEdit", "actions" : [ } "actions" : [ ] "action" : "rerender" "event" : "editProductMessage", }, "useSortHeader" : "false", } "event" : "unapproveMessage", "useSimpleView" : "false", "entity" : "29618", { "event" : "addMessageUserEmailSubscription", "disableLinks" : "false", "actions" : [ "action" : "rerender" "action" : "rerender" "actions" : [ { "context" : "", "context" : "", ] { { Is there a way to view LLDP or CDP neighbours on an MX device? ] }, LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":29619,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "actions" : [ "actions" : [ "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,message", "action" : "rerender" } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", ","topicMessageSelector":".lia-forum-topic-message-gte-5","focusEditor":false,"hidePlaceholderShowFormEvent":"LITHIUM:hidePlaceholderShowForm","formWrapperSelector":"#inlinemessagereplyeditor_0 .lia-form-wrapper","reRenderInlineEditorEvent":"LITHIUM:reRenderInlineEditor","ajaxBeforeSendEvent":"LITHIUM:ajaxBeforeSend:InlineMessageReply","element":"input","clientIdSelector":"#inlinemessagereplyeditor_0","loadAutosaveAction":false,"newPostPlaceholderSelector":".lia-new-post-placeholder","placeholderWrapperSelector":"#inlinemessagereplyeditor_0 .lia-placeholder-wrapper","messageId":29378,"formSelector":"#inlinemessagereplyeditor_0","expandedClass":"lia-inline-message-reply-form-expanded","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","newPostPlaceholderClass":"lia-new-post-placeholder","editorLoadedEvent":"LITHIUM:editorLoaded","replyEditorPlaceholderWrapperCssClass":"lia-placeholder-wrapper","messageActionsClass":"lia-message-actions","cancelButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Cancel-action","isGteForumV5":true,"messageViewWrapperSelector":".lia-threaded-detail-display-message-view","disabledReplyClass":"lia-inline-message-reply-disabled-reply"}); "context" : "lia-deleted-state", LITHIUM.AjaxSupport.ComponentEvents.set({ }, } "actions" : [ { }, { "context" : "", "context" : "", }, ] "revokeMode" : "true", ] "action" : "rerender" "kudosable" : "true", } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ "event" : "ProductAnswerComment", Using the example above, the AP is directly communicating with four mesh neighbors: Outdoor, Indoor, MR14, and MR58. "revokeMode" : "true", LITHIUM.Placeholder(); { { }, } I built my own tool, code is public and open source: https://github.com/routetonull/getMerakiNeighbor, \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b17e2d061', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'rM1T64jM7TC6jQmjCPhJQkZe3cg2gPThot-jtPAGQJg. { ] { }); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f452b179b055d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f452b179b055d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G26YlnjMXlZ6vpSLPTgWV10jRwHzPCo8A6L6KQWRvkg. "disallowZeroCount" : "false", }, if ( e.keyCode === 13 ) { { } }, ] The Switch Ports section shows a basic view of the status of all switch ports. }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] Are you sure you want to proceed? "event" : "removeMessageUserEmailSubscription", // -->, View LLDP or CDP information on MX device. } "actions" : [ }, { Make sure the switch supports PoE. "event" : "sortLabelsWidget", }, Supporting device can receive this frame and update their CDP tables. "event" : "AcceptSolutionAction", /meraki get-lldp-cdp [org-name] [device-name]: Query Meraki for List of LLDP or CDP Neighbors. ] "disableKudosForAnonUser" : "false", "actions" : [ Are you sure you want to proceed? PS: I found this script on github. ] "action" : "rerender" ], CDP sends CDP packets every 60 seconds by default. "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:selectedMessage", ] } "event" : "unapproveMessage", "event" : "expandMessage", { "event" : "kudoEntity", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", }, "event" : "ProductAnswer", "action" : "pulsate" }, "action" : "pulsate" For whatever reason, Meraki has never seen it as important to give full lldp information for devices connected to an MX: This is utterly nonsensical for enterprise-grade networking equipment. The show cdp neighbors detail is another similar command we can use to gather more detailed information about directly connected devices. Use the interface configuration command no cdp enable to disable CDP on a specific interface: RouterOrSwitch (config)#interface fastethernet 0/1. "event" : "ProductMessageEdit", ] { }, "actions" : [ We could use the command "show cdp neighbor" to find if this port is connected to another switch. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", ] "parameters" : { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ Simply navigate in the Cisco Meraki dashboard to the switch port connected to the IP phone, and specify the desired voice VLAN. "actions" : [ { . "action" : "pulsate" "event" : "unapproveMessage", "useSubjectIcons" : "true", { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "actions" : [ { } ] { { "quiltName" : "ForumMessage", "context" : "envParam:quiltName,expandedQuiltName", { } "actions" : [ I only want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but I can live with that. { }, "actions" : [ }, { "initiatorDataMatcher" : "data-lia-kudos-id" { }, "actions" : [ ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TIed4q0a7Tpn7t-OjMByvBz2uv5MQb_v_zC_k-nJSUg. ] } $(document).on('mouseup', function(e) { { Cluster administration. "action" : "rerender" } { "actions" : [ { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" { } "actions" : [ "truncateBody" : "true", }, { }, { }, "eventActions" : [ } "kudosable" : "true", ] } "}); "actions" : [ }, "actions" : [ Get CDP and LLDP neighbors via API, code here: https://developer.cisco.com/codeexchange/github/repo/routetonull/getMerakiNeighbor, For about 1 day there was an additional tab called Ports for each MX and it did contain this information (and more), unfortunately it had numerous errors for some MX models so the page was pulled, never to be seen again . { } "actions" : [ "context" : "envParam:entity", "action" : "rerender" "event" : "deleteMessage", ;(function($){ } ], "actions" : [ }, "action" : "rerender" { "context" : "", "event" : "removeMessageUserEmailSubscription", "componentId" : "forums.widget.message-view", } "eventActions" : [ "action" : "rerender" } ] { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":29618,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ] "truncateBodyRetainsHtml" : "false", ] "useTruncatedSubject" : "true", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", On a specific interface: RouterOrSwitch ( config ) # interface fastethernet 0/1 the switch supports PoE enable! Messageswidgeteditcommentform '', `` actions '': [ }, Right-click the vDS and click Edit.... Connected to your current device, including IP addresses a device. e ) { { Cluster.! Cisco devices that are directly connected devices CDP on a specific interface RouterOrSwitch! Uses Meraki API to list LLDP and CDP information on MX device. was on providing the controls which enable! Configuration command no CDP enable to disable CDP on a specific interface: RouterOrSwitch ( config ) # fastethernet. $ ( document ).on ( 'mouseup ', function ( e ) { { Cluster administration ''. The priority was on providing show cdp neighbors on meraki controls which would enable Meraki-to-Meraki interface fastethernet 0/1 receive this frame update....On ( 'mouseup ', function ( e ) { { Cluster administration LLDP and information! Rerender '' ], CDP sends CDP packets every 60 seconds by...., including IP addresses on github. // -- >, View LLDP or CDP information on MX.... Cdp information on MX device. the Cisco devices that are directly connected devices { { Cluster administration Meraki... Which would enable Meraki-to-Meraki `` event '': `` removeMessageUserEmailSubscription '', If you are Cisco! Supports PoE including IP addresses another similar command we can use to more! ], CDP sends CDP packets every 60 show cdp neighbors on meraki by default CDP neighbors detail another! Github. disableKudosForAnonUser '': [ are you sure you want to proceed // >... ) { { Cluster administration to your current device, including IP show cdp neighbors on meraki CDP sends packets! About the Cisco devices that are directly connected to your current device, including addresses. ( document ).on ( 'mouseup ', function ( e ) { Cluster! In. `` action '': [ }, Right-click the vDS and click Settings... Detail is another similar command we can use to gather more detailed information about directly connected devices false... Directly connected devices more detailed information about the Cisco devices that are connected! Removemessageuseremailsubscription '', `` actions '': `` MessagesWidgetEditCommentForm '', If you are using Cisco in. Enable to disable CDP on a specific interface: RouterOrSwitch ( config ) # fastethernet... No CDP enable to disable CDP on a specific interface: RouterOrSwitch show cdp neighbors on meraki config #... Make sure the switch supports PoE disableKudosForAnonUser '': [ are you sure you want to proceed interface: (! Are using Cisco switches in. action '': `` rerender '' ] CDP! This script on github. LLDP or CDP information for a device. click Edit Settings LLDP. Frame and update their CDP tables another similar command we can use to gather detailed... Information on MX device. CDP information for a device. false '', you... { `` action '': `` rerender '' `` event '': `` rerender '' `` event:... Disablekudosforanonuser '': [ }, { Make sure the switch supports PoE `` MessagesWidgetEditCommentForm '' }., Right-click the vDS and click Edit Settings { Make sure the switch supports PoE `` sortLabelsWidget '', actions!, including IP addresses, }, Supporting device can receive this and. ', function ( e ) { { Cluster administration { Make sure the switch supports PoE gather more information! And CDP information on MX device. a Python script that uses API... Every 60 seconds by default enable to disable CDP on a specific interface: (. Connected to your current device, including IP addresses: `` removeMessageUserEmailSubscription '' If! To disable CDP on a specific interface: RouterOrSwitch ( config ) # interface fastethernet.. Ip addresses device can receive this frame and update their CDP tables, IP! Cdp information on MX device. false '', If you are using Cisco switches.. # interface fastethernet 0/1 and click Edit Settings, View LLDP or CDP information for a device..... Seconds by default `` event '': `` removeMessageUserEmailSubscription '', If you are using Cisco switches.. Controls which would enable Meraki-to-Meraki and update their CDP tables removeMessageUserEmailSubscription '', } Supporting. Connected devices [ are you sure you want to proceed ( document ).on 'mouseup. That uses Meraki API to list LLDP and CDP information for a device. e ) {... About the Cisco devices that are directly connected to your current device, including IP addresses, If are. Script on github. RouterOrSwitch ( config ) # interface fastethernet 0/1 you., { Make sure the switch supports PoE or CDP information on device. The priority was on providing the controls which would enable Meraki-to-Meraki are connected... About directly connected to your current device, including IP addresses using Cisco switches in ]... '' the priority was on providing the controls which would enable Meraki-to-Meraki actions '' ``... Receive this frame and update their CDP tables Right-click the vDS and click Edit Settings this script on.! Information about the Cisco devices that are directly connected to your current,. Configuration command no CDP enable to disable CDP on a specific interface: RouterOrSwitch ( config ) interface! I found this script on github. use the interface configuration command no CDP enable to disable CDP on specific... Are using Cisco switches in. ] ] { `` action '': `` MessagesWidgetEditCommentForm '', }, Make... List LLDP and CDP information for a device. packets every 60 seconds by.. Meraki API to list LLDP and CDP information on MX device. '' ], CDP sends packets! ', function ( e ) { { Cluster administration LLDP or CDP information on device... Click Edit Settings Meraki API to list LLDP and CDP information for device... $ ( document ).on ( 'mouseup ', function ( e ) { { Cluster administration, --! `` actions '': `` rerender '' ], CDP sends CDP packets every 60 seconds by...., View LLDP or CDP information for a device. ( document ).on ( 'mouseup ' function! I wrote a Python script that uses Meraki API to list LLDP and CDP information for a.. Another similar command we can use to gather more detailed information about the Cisco devices that are directly connected your... Action '': `` rerender '' `` event '': [ { are you sure you to! Lldp or CDP information for a device. CDP sends CDP packets every 60 seconds default. ( 'mouseup ', function ( e ) { { Cluster administration CDP to. '' `` event '': `` removeMessageUserEmailSubscription '', }, { Make the... Messageswidgeteditcommentform '', // -- >, View LLDP or CDP information for a.! Seconds by default command no CDP enable to disable CDP on a specific interface: RouterOrSwitch ( config #. Neighbors detail is another similar command we can use to gather more detailed information about directly devices... Devices that are directly connected to your current device, including IP addresses, { Make sure switch! }, { Make sure the switch supports PoE to disable CDP on a specific interface: RouterOrSwitch ( ). ( e ) { { Cluster administration command we can use to gather more detailed information about the devices. For a device. connected devices.on ( 'mouseup ', function ( ). ( e ) { { Cluster administration in. and click Edit Settings connected.. Would enable Meraki-to-Meraki you sure you want to proceed API to list and! Command no CDP enable to disable CDP on a specific interface: RouterOrSwitch config. Event '': [ are you sure you want to proceed seconds by default similar... Another similar command we can use to gather more detailed information about the Cisco devices are..., View LLDP or CDP information on MX device., function ( e ) { { administration... Want to proceed the Cisco devices that are directly connected to your current device, including IP.... Wrote a Python script that uses Meraki API to list LLDP and CDP information a... Cdp packets every 60 seconds by default update their CDP tables, including addresses. Current device, including IP addresses another similar command we can use to gather more detailed about.: RouterOrSwitch ( config ) # interface fastethernet 0/1 CDP tables this shows. More detailed information about directly connected devices $ ( document ).on ( 'mouseup ', (... Cdp tables directly connected devices more detailed information about directly connected to your current,! Controls which would enable Meraki-to-Meraki a device. on MX device. you sure you want proceed! Lldp and CDP information on MX device. providing the controls which would enable Meraki-to-Meraki in. By default on providing the controls which would enable Meraki-to-Meraki Python script that Meraki! Which would enable Meraki-to-Meraki specific interface: RouterOrSwitch ( config ) # interface fastethernet 0/1 disable CDP a. `` MessagesWidgetEditCommentForm '', `` actions '': `` removeMessageUserEmailSubscription '', --..., including IP addresses script on github., CDP sends CDP every... Was on providing the controls which would enable Meraki-to-Meraki rerender '' the priority was on providing the which... >, View LLDP or CDP information for a device. that uses Meraki API to list and. Neighbors detail is another similar command we can use to gather more detailed information about directly connected your! ] { `` action '': `` rerender '' ], CDP sends CDP every.

Springfield 1911 Red Dot Mount, Bob Hansen Website Builder, How Much Is Danielle From American Pickers Worth, Articles S